PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10034372
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MYB
Protein Properties Length: 225aa    MW: 25569.5 Da    PI: 9.1936
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10034372genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding506.8e-161562148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT++Ed+ll ++v+++G g+W+++++  g++R++k+ ++rw +yl
      Lus10034372 15 KGPWTPQEDKLLTEYVNLHGEGRWSSVSKSTGLKRSGKSSRLRWVNYL 62
                     79********************************************97 PP

2Myb_DNA-binding47.63.7e-1568112147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg  T++E+ + +++++ +G++ W+tIa++++ gRt++++k++w+++
      Lus10034372  68 RGQLTPQEEGIVIELHAVWGNK-WSTIASYLP-GRTDNEIKNYWRTH 112
                      7888******************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.5321062IPR017930Myb domain
SuperFamilySSF466892.4E-2812109IPR009057Homeodomain-like
SMARTSM007171.3E-131464IPR001005SANT/Myb domain
PfamPF002492.7E-151562IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.3E-201669IPR009057Homeodomain-like
CDDcd001677.91E-101762No hitNo description
PROSITE profilePS5129423.5863117IPR017930Myb domain
SMARTSM007171.8E-1267115IPR001005SANT/Myb domain
PfamPF002492.1E-1368112IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.3E-2370116IPR009057Homeodomain-like
CDDcd001673.67E-972113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 225 aa     Download sequence    Send to blast
MMMRGYGVDE QGWRKGPWTP QEDKLLTEYV NLHGEGRWSS VSKSTGLKRS GKSSRLRWVN  60
YLRPGLKRGQ LTPQEEGIVI ELHAVWGNKW STIASYLPGR TDNEIKNYWR THFKKRSSSS  120
SSLPRNPKRR KSSSAVTNDQ QTINIHANHS SGHDSCTIDH DQKMQLDTLL LTDGNCQKQQ  180
QSCSGHNMNE FENHQWADDH LVPAAAFGSG TIIEDSLWSC LWNF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-23151197110B-MYB
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1113130KKRSSSSSSLPRNPKRRK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010113169.11e-70Transcription factor
TrEMBLA0A059ARJ31e-70A0A059ARJ3_EUCGR; Uncharacterized protein (Fragment)
TrEMBLW9SN562e-70W9SN56_9R
STRINGSolyc02g089190.1.11e-66(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF118234108
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G30210.15e-59myb domain protein 121